Renee Hayes
Friday
Apr 26, 2024
besidesdressextrashoeshoesstreamtalkstinytrustwords
Load
Renee Hayes
Friday
Apr 26, 2024
arrestallowappointclaimdewdueefforteitherestateincludeinformationledgepositionprimaryrememberresultservespecialwhowhom
Load
sped 5th grade reading
lillie
Friday
Apr 26, 2024
cochlear implantcochlear implant devicecochlear implant hearingaidecrydanny and samantha fentondanny and samantha fenton agree’s with doctor’s on emergency ear surgery for theire twin babie’s mckenna and sophia. but. doctor’s need’s danny fenton to go into phantom to help with the babies. but he’s too scared. but he goe’s ghost and help’s out. use’s his ghost cllaw’s to cut above theire ear’s and put permanent-prosthetic eardrum-itc cochlear implant hearingaide devce’s. and an eardrum pacemaker device over theire artificial eardrum’s. so the ear’s can have constant-frequent check up-ear exam’s. but then stich up the ear’s from theire ear’s attached to the bone behind theire ear’s. danny feel’s bad. and traumatized he had to do this. he was forced into this surgery of thees babies. he never wanted to hurt themdanny and samantha fenton are shocked to hear theire infant newborn twin baby daughter’s: mckenna. and sophia. are born profoundly deafmute. and are born without eadrum’s. and would need an emergency permanent-prosthetic-eardrum-in the-ear-canal cocolar-implant hearingaide-ear surgery. wich really scare’s mommy and daddy. theire in profound shockdanny fentondanny fenton-phantomdanny phantomdeaf-mute fenton twin’s mckenna and sophiadeaf-mute fenton-phantom twin’s mckenna and sophiadeaf-mute phantom twin’s mckenna and sophiadepressiondrinking in shockdrinking in traumatic stressdrinking in traumatic stressdrinking out of schockdrinking out of traumadrinking out of traumatic stressdrinking while depresseddrinking while in depressiondrinking with depressiondrinking with shockdrinking with traumadrinking with traumatic stressfearmckenna and sophia fentonmckenna and sophia fenton-phantommckenna and sophia phantomprofound traumatic fearprofound traumatized stressfull fearsamantha fentonsamantha fenton-phantomsamantha phantomscaredsmoking in shocksmoking in traumatic stresssmoking out of shocksmoking out of traumasmoking out of traumatic stresssmoking with shocksmoking with traumasmoking with traumatic stress
Load
loris evelyn salina
Friday
Apr 26, 2024
absolutearenacomplimentdeliberatedensedominanthazardoushuddlenecessityoffendregainthorough
Load
sped 4/6 reading 641634-1084974-7krz
lillie
Friday
Apr 26, 2024
crydanny and samantha fenton agree’s with doctor’s on emergency ear surgery for theire twin babie’s mckenna and sophia. but. doctor’s need’s danny fenton to go into phantom to help with the babies. but he’s too scared. but he goe’s ghost and help’s out. use’s his ghost cllaw’s to cut above theire ear’s and put permanent-prosthetic eardrum-itc cochlear implant hearingaide devce’s. and an eardrum pacemaker device over theire artificial eardrum’s. so the ear’s can have constant-frequent check up-ear exam’s. but then stich up the ear’s from theire ear’s attached to the bone behind theire ear’s. danny feel’s bad. and traumatized he had to do this. he was forced into this surgery of thees babies. he never wanted to hurt themdanny and samantha fenton are shocked to hear theire infant newborn twin baby daughter’s: mckenna. and sophia. are born profoundly deafmute. and are born without eadrum’s. and would need an emergency permanent-prosthetic-eardrum-in the-ear-canal cocolar-implant hearingaide-ear surgery. wich really scare’s mommy and daddy. theire in profound shockdrinking in angerdrinking in feardrinking in stressdrinking in traumatic stressdrinking out of anxietydrinking out of depressiondrinking out of feardrinking out of ptsddrinking out of stressdrinking out of traumadrinking out of traumatic stressdrinking with depressiondrinking with ptsddrinking with traumadrinking with traumatic stresssmoking in angersmoking in fearsmoking in stresssmoking in traumatic stresssmoking out of anxietysmoking out of depressionsmoking out of fearsmoking out of ptsdsmoking out of stresssmoking out of traumasmoking out of traumatic stresssmoking with depressionsmoking with ptsdsmoking with traumasmoking with traumatic stress
Load
U11 W1
Katie Bozone
Friday
Apr 26, 2024
adjoiningannoyingavoidedboycottcorduroydeployeddisappointecologyemployeeespeciallyholeloyaltymoistureoystersparanoidrejoicesoybeantenderlointurquoisewhole
Load
Unit 11 Week 2
Katie Bozone
Friday
Apr 26, 2024
accountableallowanceannouncementastoundingbackgroundbelievebloodhoundboundariescounselorcowardlydismountdownloaddrownedempoweredenvironmentfavoritefoundationgrowledmouthwashtowering
Load
R4R Unit 8 Week 3
Friday
Apr 26, 2024
abandonachieveadeptalasamendbraverychucklegentlehumanhumanehurdlenobleraiserisestruggletendencytreatytrophy
Load
Rikki Tikki Tavi
Friday
Apr 26, 2024
BalancingBredBroodBungalowClenched Consolation Cunningly FractionImmensely Inherited Mourning ParalyzedPeculiar RevivedSavagelyScornfullyScuttledSplendidThicketsValiantVeranda
Load
Week 4/29
Friday
Apr 26, 2024
bewilderboycottcondemndeterioratefeeblemomentumrationreluctantsubsequenttrudge
Load
Friday
Apr 26, 2024
BlackBlueBrownColorsFloorGreen HeadLockOrangePinkPurple RedWhiteYellow
Load
Week 25
Karie Feng
Friday
Apr 26, 2024
airalwaysbothdelightfulespeciallyexamplegotgrouplifemightnextoftenpaperrunthose
Load
My Side 4
Friday
Apr 26, 2024
adornedbearingcomplaintconservationistsdevourfatigueferocityhumanityindignityingenuityinsulatingmomentumoriginatedoutwitplumageprecautionprobabilityquarryrenditionresoundingsensationalismserenadesuperbutterlywistfully
Load
My Side 3
Friday
Apr 26, 2024
abundancebackwateringcarcasschitteringevidentlyferociousfragrantfurtivelyhystericsluremaneuversmarksmanshipmembranepersonablepoachingpreenedprovokequarteredracketeerreassuredscuttledtarrytediousvengeancewinced
Load
sped 5th reading 641623-1084908-pb6n
Friday
Apr 26, 2024
architectautisticcrydanny fenton witness his and samantha's twin daughter's: mckenna. and sophia. drinking pickle juice. he think's to himself "oh, gosh! that's disgusting!" but then. he say's to them: "ok girl's. let me see it. i'll let yall drnk it." but he gag'sdanny fenton-phantom witness his and samantha's twin daughter's: mckenna. and sophia. drinking pickle juice. he think's to himself "oh, gosh! that's disgusting!" but then. he say's to them: "ok girl's. let me see it. i'll let yall drnk it." but he gag'sdanny phantom witness his and samantha's twin daughter's: mckenna. and sophia. drinking pickle juice. he think's to himself "oh, gosh! that's disgusting!" but then. he say's to them: "ok girl's. let me see it. i'll let yall drnk it." but he gag'sdepakotedrinking pickle juicemccormick style red pepper pepricka garlic and cinnamon rubbed meatless chicken n' cayenne pepper sauce soaked bell pepper vegan-sausage sauteed veggie'smckenna and sophia fenton are mutemckenna and sophia fenton-phantom are mutemckenna and sophia fenton-phantom are severely mute. using mute skill's- communicating silently to architect theire victoriesmckenna and sophia fenton-phantom enjoy's an occasional weekly pickle juice in a shotcupmckenna and sophia fenton-phantom. as mute's. may architect their victoriesmckenna and sophia fenton-phantom. take's depakotemckenna and sophia fenton-phantom. take's depakote for seizure disorder'smckenna and sophia fenton-phantom. take's depakote for seizure'smckenna and sophia phantom are mutemuteoccasional pickle juice in a shotcupoutshoutpickle juice in a shotcupshotcupshysilent samuraisilent samurai skill'ssilent samurai skills have the villains on the runverbal therapy for mckenna and sophia fentonverbal therapy for mckenna and sophia fenton-phantomverbal therapy for mckenna and sophia phantomverbal therapy for nonverbal autismvocal cord therapy for mckenna and sophia fentonvocal cord therapy for mckenna and sophia fenton-phantomvocal cord therapy for mckenna and sophia phantomvocal cord therapy for nonverbal autismvocal therapy for mckenna and sophia fentonvocal therapy for mckenna and sophia fenton-phantomvocal therapy for mckenna and sophia phantomvocal therapy for nonverbal autismweekly pickle juice in a shotcup
Load
Master before starting part 1
Friday
Apr 26, 2024
AreBeBoyForGoLookNoOfOhOrPutSaidSoTheTheyTo
Load
Friday
Apr 26, 2024
1 and 2 CorinthiansCelsius scaleFahrenheit scaleGalatians Jet streamTempestuousaridatmospherebalmybarometerblizzard blusteryclimaticcondensationcyclonedelugedroughtevaporationforecasthazyhumidityhurricanehygrometerice crystallightningmoistureprecipitationsqualltemperaturethermometertornadoestropicalturbulencetyphoonweathervane
Load
Cenella Lee
Friday
Apr 26, 2024
ADDITIONAUTUMNALCELEBRATIONCEREMONIALCHANNELCHILDRENFESTIVALFRECKLEFUNNELGENERATIONHOSPITALIMPORTANTNATIONRUSTLESCUTTLESUBTRACTIONTRAVELTRIALTRICKLEVOWELWOBBLE
Load
Mariposas Ch 16-18
Friday
Apr 26, 2024
amidstantibioticsassortmentbrimmingcynicalenamoredintricatelyiridescentluminousmeagermystifiedneglectnurturesoffspringproddingserenelysopapillassplendorsurrealtrampled
Load
sped 5th reading 641618-1084898-2rg7
jacie
Friday
Apr 26, 2024
crydanny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. softly-gently tightly hold's them carefully with love's. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of hug's and kissesmccormick style red pepper pepricka garlic and cinnamon rubbed meatless chicken n' cayenne pepper sauce soaked bell pepper vegan-sausage sauteed veggie'smckenna and sophia fenton-phantom enjoy's an occasional weekly pickle juice in a shotcupoccasionaloccasional pickle juice in a shotcupoccasionallyoccupationalpickle juice in a shotcupscoliosisseldomseldomlyshotcupspeech therapyverbal therapy for nonverbal autismvocal cord therapy for nonverbal autismvocal therapy for nonverbal autismweekly pickle juice in a shotcup
Load
Rosemarie Meza
Friday
Apr 26, 2024
engineersoftwaresorghumstimulasstraitssynthetictenacletendonterracesthermostattranspirationtrapizoidtrembletriathlontropospheretsumanitundratungstenvascularvertexverticalvictoriouslyvoguevollyballwetland
Load
Frequently Misspelled Words (Group 2)
Friday
Apr 26, 2024
alsoalwaysanythinganywayeveryonefirstoncereallywhilewhole
Load
Unit 4 Vocab
Nicolette Gramlick
Friday
Apr 26, 2024
airatmospherebiomebiospherecrustgeosphereglaciersground waterhuman impacthydrosphereinner corekingdomsliftingmantlemeteorologynitrogenouter coreozone layerrainforestsaltwatersoilsurface watertropospherewater vaporwind funnel
Load
UNIT 4 WEEK 5
Diona Kimbrell
Friday
Apr 26, 2024
antibioticaudibleaudienceaudioaudiobookaudiologistaudiologyaudiotapeaudiovisualauditoriumbiodegradablebiodiversitybiographerbiographybiologistbiologybiomebiopsybiosphereinaudiblemicrobiologistsymbiotic
Load
sped 5th reading 641613-1084884-qdxw
lillie
Friday
Apr 26, 2024
danny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. softly-gently tightly hold's them carefully with love's. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of hug's and kissesmckenna and sophia fenton burping really loud. danny (theire daddy) love's this. and think's it's funny of themmckenna and sophia fenton get's confused around unfamiliar thing's. people. place's or surrounding'smckenna and sophia fenton get's confused around unfamiliar thing's. people. place's or surrounding's. including situation'smckenna and sophia fenton love's eating pickle'smckenna and sophia fenton love's enjoying a weekly pickle icee's treatmckenna and sophia fenton-phantom burping really loud. danny (theire daddy) love's this. and think's it's funny of themmckenna and sophia fenton-phantom enjoy's an occasional weekly pickle juice in a shotcupmckenna and sophia phantom burping really loud. danny (theire daddy) love's this. and think's it's funny of themmommy and daddy use nondisciplinary action's on mckenna and sophiamutephantom burpphantom burpingpickle icee'sroll with laughterrolling with laughterrolls with laughtersensory bedroomsensory bedroom for mckenna and sophia fentonsensory friendly bedroomsnow cone
Load
sped 5 reading 641612
lillie
Friday
Apr 26, 2024
crydanny and samantha fenton giving tight-warm clinging hug's. and warm-gentle kisses to theire youngest kid's- twin daughter's: mckenna. and sophia. the twin's enjoy's this lovedanny and samantha fenton use nondisciplinary action's on mckenna and sophiadanny and samantha fenton-phantom finally turning theire disabled youngest kid's- five year old twin daughter's: mckenna and sophia into ghost. they explain the whole family is ghost. and they explain theire phantom development. the twin's are freaked out as they turn them into ghost. theire scared. and tyeire confused. mommy and daddy trie's calming them down. the twin's unknowingly and unintentionally fight mommy and daddy. and unknowingly and unintentionally refuse and resist transision. daddy no disciplinarian-restrain's them to calm down. but he just trie's soothing them with soft-kind gentle verbal warning. and soft-kind gentle loving hand's to chest as theire being lay'd on theire back's. he put's a soft-gentle hand to theire face to theire chin. and he talk's kindly-gently to them. and give's alot of warm-comforting love. and a soft-firm tender kind-tight gentle warm hug. and alot of soft-firm tender kind-tight gentle warm kisses to theire head and face. and he smile's at them to cheer and comfort themdanny and samantha fenton-phantom use nondisciplinary action's on mckenna and sophiadanny and samantha fenton-phantom use nondisciplinary action's on mckenna and sophiadanny and samantha fenton-phantom witnesses mckenna and sophia making scared-confused look's on theire cute little human face'sdanny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of tight warm hug's and sweet-warm kissesdanny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. softly-gently tightly hold's them carefully with love's. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of hug's and kissesdanny and samantha fenton-phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying food'sdanny and samantha fenton-phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying new food's. they don't forcefeeddanny and samantha fenton. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying new food's. they don't forcefeeddanny and samantha phantom use nondisciplinary action's on mckenna and sophiadanny and samantha phantom use nondisciplinary action's on mckenna and sophiadanny and samantha phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying new food's. they don't forcefeeddanny fentondanny fenton-phantomdanny phantomloud burploud burpingmckenna and sophia fenton burping really loud. danny (theire daddy) love's this. and think's it's funny of themmckenna and sophia fenton was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairymckenna and sophia fenton-phantom burping really loud. danny (theire daddy) love's this. and think's it's funny of themmckenna and sophia phantom burping really loud. danny (theire daddy) love's this. and think's it's funny of themmckenna or sophia fenton not understanding anything mommy or daddy is trying to tell to them about the whole family being ghostmckenna or sophia fenton not understanding anything mommy or daddy is trying to tell to them about the whole family being ghost. theire really scaredmommy and daddy are nondisciplinarian's toward's mckenna and sophiamommy and daddy use nondisciplinary action's on mckenna and sophianappingno punishment on mckenna or fentonno punishment on mckenna or fenton-phantomno punishment on mckenna or phantomnondisciplinariannondisciplinarian for fenton twin'snondisciplinary actionnondisciplineprofound disabilitiessnow cone
Load
UFLI Review for Lesson 44
April Buchner
Friday
Apr 26, 2024
getgoeslocknotsayssicktrickyour
Load
School Related TERMS
Friday
Apr 26, 2024
assemblybathroombell schedulecafeteriaclassroomcollegecounselorelectivesexamsfield tripfriendsgrade point averagegraduationgymnasiumhealthroomhomeworklockerprincipalpromseniorssportstardyteacherwateryearbook
Load
m
Friday
Apr 26, 2024
acceptableadvisableamiableavailablebruiseconsiderablecurabledelectabledependabledesirablefulfilirritablelikeable lovablemalleablemistakable movablenoticeablesuitableunshakeablevariable
Load
Extra Spelling
C Moura
Friday
Apr 26, 2024
affectbatterycommunitydiscomfortdislikedistracting effectelectricityformula prismpyramidrecyclereplacingshapestreatment
Load
Unit 6 Week 1
Amber Henderson
Friday
Apr 26, 2024
dislikelabelprecookpresalerebuildreprintreturntinyunluckyunwrap
Load
Charlotte's Web List 3 and 4
Friday
Apr 26, 2024
beautifulboastexplosiongoosegroundgulliblehappyhystericsmiraclemorningoverpersuadepromisesedentarysheepsomethingterrificvaguelyverywondrous
Load
Spelling Packet 4/29 -5/3
Friday
Apr 26, 2024
AmazingAwesomeCrazierEarlierEasierFantasticFunnierHappierTerrificWonderful
Load
Q4 Spelling Week 2
Friday
Apr 26, 2024
architectbayonetdecipherman-of-warmerchantomenprowlingrebelsacrificeshantysuperstitiontatteredtempletraitorvessel
Load
Wonders Spelling Unit 6 Week 1
4th Grade
Friday
Apr 26, 2024
buttoncommoncottoncousindragonelevenmuffinoftenpenguinprovenraisinreasonriddenrobinshakenskeletonsunkenwagonwidenwoven
Load
Friday
Apr 26, 2024
actuallyawhilecomputerfeatureinformationinquirelocalopinionparagraphpicturepresentprintpublicationpublishpurposequiteregardreportsimilarsinglesolutionsolvestatementsubjectview
Load
Fundations Week 10 Lesson 2a
Tammy Rose
Friday
Apr 26, 2024
beneathbreadbrownieceilingchimneycookieeatfiercegeniemasterpieceoceanpailpalequeenremindsailsalesteakthirstyworld
Load
Words with -ly -ful
Oula Subei
Friday
Apr 26, 2024
helpfulhopefulkindlymouthfulpainfulquicklysadlysafelyslowlystrangelythankfulusefulusuallyweeklywishfulwonderful
Load
Friday
Apr 26, 2024
PleasePrettyRanRideSawSaySheSoonThatThereTheyThisTooUnderWantWasWellWentWhatWhiteWhoWillWith
Load
Friday
Apr 26, 2024
AreAtAteBrownButCameDidDoEatFourGetHaveHeIntoLikeMustNewNowOurOut
Load
Group 3 April/May sightwords
Denise Toles
Friday
Apr 26, 2024
BrotherCertainCompareFirsGrewIslandMyselfPartyPeoplePleaseSurfaceTowardWaterWerepleasure
Load
'Group 4 April/May sightwords
Denise Toles
Friday
Apr 26, 2024
CarryDuringExampleFigureGovermentLaterMachineNoticeNumeral PresentScienceShowSuddenlyThirdThrough
Load
Karie Feng
Friday
Apr 26, 2024
airalwaysbothdelightfulexamplegotgrouplifemightnextoftenpaperrunthose
Load
List 22- Words y changing to i plus a suffix
Friday
Apr 26, 2024
babiescarriedcitiescriesdeniedearlierflieshappinesshurriedkindnessloveliestmemoriespartiespenniesponiespuppiesrejoinsoftnessspiedstoriestriedunwrap
Load
List 29
Karen Lashley
Friday
Apr 26, 2024
disagreedisappeardisappointdishonestdislikemisbehavemisplacemisspellmisunderstandmisuserebuildrecallreviewrewriteunableunbeatenuncertainuncomfortableunkindunknown
Load
Module 9 Week 3
Friday
Apr 26, 2024
autographbiligybiographycalligraphyhomographhomophonemegaphonemicrophonemicroscopemicrowaveparagraphphotocopyphotographphotosynthesissaxophonesymphonytelegraphtelephontelescopeetelescopexylophone
Load
sped 5 reading 641591-1084691-t7zv
lillie
Friday
Apr 26, 2024
bubble'sclassic galactosemia eating disorder'scrycryingdanny and samantha fenton giving tight-warm clinging hug's. and warm-gentle kisses to theire youngest kid's- twin daughter's: mckenna. and sophia. the twin's enjoy's this lovedanny and samantha fenton giving tight-warm clinging hug's. and warm-gentle kisses to theire youngest kid's- twin daughter's: mckenna. and sophia. the twin's enjoy's this lovedanny and samantha fenton take's theire youngest kid's- twin daughter's: mckenna and sophia. to a metabolic doctor. to find out why theire not eating. doctor's test's theire enzyme's. classic galactosemia levle's. and enzyme levels. all very low in a 0. but they have high galactose level of 12.8 amount of galactose in theire bodie's. wich need's to get the galactose out of them. this scare's mommy and daddy to see galactose in them. but let's the doctor's do whatever they need to do for them to get it out of them. but mommy and daddy tell's doctor's "wait. before you do anything. we need to explain this to the twin's. or they'd really be scared." so they allow. they explain to the twin's. and hug tightly. and give several kisses to theire head. they start clinging mommy and daddy. but then trie's calming them down. doctor's also tell's parent's they don't have stomach. is why they don't eat. they encourage them to gently forcefeed them enough to gain weight. and they tell them theire dygestive level is 0. they really need to eat. this really scare's mommy and daddy. the twin's are in emergency surgery to get the toxic galactose poisoning toxin's out of themdanny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of hug's and kissesdanny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of hug's and kissesdanny and samantha fenton-phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying food'sdanny and samantha fenton-phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying food's. they don't forcefeeddanny and samantha fenton-phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying new food's. they don't forcefeeddanny and samantha fenton. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying food's. they don't forcefeeddanny and samantha fenton. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying new food's. they don't forcefeeddanny and samantha phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying food'sdanny and samantha phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying food's. they don't forcefeeddanny and samantha phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying new food's. they don't forcefeeddanny hold's onto his and samantha's five year old babies. mckenna and sophia. after they wake up in ghost transision. mckenna and sophia are so scared. they ask mommy and daddy "why doe's it have to hurt so much?" mommy and daddy look at eachother in shock with theire question. but then theire wondering the samethingeating disorder'sgalactosemia eating disorder'shesitant to speakmckenna and sophia fenton are awake from emergency surgery. but theire scared. and are hurting. doctor's explain's theire gonna' have traumatic scar's for life from theire surgery. mommy and daddy are sad for this. daddy look's at theire scar's on theire stomach. the twin's scream to mommy and daddy. "mommy! daddy! stomach burn's!" danny slowly-gently use's an icecore on theire bandaged stomach. the twin's make's a scared face in screaming fear "cold-cold." so daddy trie's to calm them down with a fireball to theire chest. he say's "calm down babie's." they clinge himmckenna and sophia fenton are screaming and crying. and in pain. stress. and fear. and are squirming. and theire unknowingly and unintentionally resisting mommy and daddy as they turn them into ghost. mommy or daddy don't allow this. but they don't punish or discipline them. they just try calming them down with soft gentle voice. verbal warning. and soft gentle touch to neck down to shoulder all the way down to lower-mid spine. and talk to them trying to calm them downmckenna and sophia fenton black's out in painfull panicing fear of becomming ghostmckenna and sophia fenton born mutemckenna and sophia fenton don't eat. this worrie's mommy and daddy. but danny (the twin's daddy). trie's them on a dairyfree classic galactosemia safe nutritional plant based vegan chocolate smoothie replacement shake-yogurt on-the-go drink. he hope's they like. wich they lovemckenna and sophia fenton first battle crymckenna and sophia fenton first ghosly wailmckenna and sophia fenton into painfull transisionmckenna and sophia fenton love's roasted marshmallow'smckenna and sophia fenton love's roasted marshmallow's. but aren't allowed to roast them unsupervised. so mommy or daddy doe's it for themmckenna and sophia fenton love's roasted marshmallow's. but aren't allowed to roast them unsupervised. so mommy or daddy doe's it for them. but let's them blow fire off theire marshmallowmckenna and sophia fenton stuttering disordermckenna and sophia fenton stuttering disorder keep's them mutemckenna and sophia fenton stuttering disorder keep's them shymckenna and sophia fenton voice therapy for nonverbal mute autism-mostly mute. including stutteringmckenna and sophia fenton was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairymckenna and sophia fenton- human form. burp's really loud. daddy in ghost form love's thismckenna and sophia fenton- human form. burp's really loud. daddy in human form love's thismckenna and sophia fenton-phantom love's kosher dill pickle'smckenna and sophia fenton-phantom was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairy. this is very sad new's to mommy and daddy to hear about theire infant twin babie'smckenna and sophia phantom was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairymckenna and sophia phantom- ghost form. burp's really loud. daddy in ghost form love's thisprofound disabilitiesverbal therapy for speech disorder's
Load
Friday
Apr 26, 2024
byintoride shethatwas
Load
Green Sort 36
Friday
Apr 26, 2024
Julyberrybodybrowniecandycherrycookiedenydizzydonkeyeeriegoaliejourneymoneymonkeymoviepinkiereplystoryturkeytwentyvalleyveryvolley
Load
List 29
Nicole Howard
Friday
Apr 26, 2024
blewbluebruisechewcoveredcruiseflewfruitgluegrouplistennewnewsscrewseveralsoupstatuestewsuitthrew
Load
Spelling Lesson 16
Joanne Wilbers
Friday
Apr 26, 2024
complaindifferentinstantinsteadoncequietquitquite
Load
Spelling 4 Language Arts Book Parts
Terri Breton
Friday
Apr 26, 2024
appendixcontentsdictionarydiscoverglossaryhelpfulindexlistsnonfictionreferencevolume
Load
sped 4/6 reading 641585-1084653-srnk
lillie
Friday
Apr 26, 2024
apple-cider vinegarette soak garlic-grilled green bean'sapple-cider vinegarette soak garlic-grilled green bean's n' cajun sauce marinated grilled garlic asparagusbalsamic vinegarette marinade style green-verde garlic style grilled asparagus and green bean'scajun style green bean'sclassic galactosemiaclassic galactosemia is a svere rare genetic-metabolic disorder babie's are born with. it's lifelong. and never goe's away. you never outgrow itcrydanny and samantha fenton giving tight-warm clinging hug's. and warm-gentle kisses to theire youngest kid's- twin daughter's: mckenna. and sophia. the twin's enjoy's this lovedanny and samantha fenton take's theire youngest kid's- twin daughter's: mckenna and sophia. to a metabolic doctor. to find out why theire not eating. doctor's test's theire enzyme's. classic galactosemia levle's. and enzyme levels. all very low in a 0. but they have high galactose level of 12.8 amount of galactose in theire bodie's. wich need's to get the galactose out of them. this scare's mommy and daddy to see galactose in them. but let's the doctor's do whatever they need to do for them to get it out of them. but mommy and daddy tell's doctor's "wait. before you do anything. we need to explain this to the twin's. or they'd really be scared." so they allow. they explain to the twin's. and hug tightly. and give several kisses to theire head. they start clinging mommy and daddy. but then trie's calming them down. doctor's also tell's parent's they don't have stomach. is why they don't eat. they encourage them to gently forcefeed them enough to gain weight. and they tell them theire dygestive level is 0. they really need to eat. this really scare's mommy and daddy. the twin's are in emergency surgery to get the toxic galactose poisoning toxin's out of themdanny and samantha fenton. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying food'sgalactosemiakosher dill pickle'smckenna and sophia fenton are awake from emergency surgery. but theire scared. and are hurting. doctor's explain's theire gonna' have traumatic scar's for life from theire surgery. mommy and daddy are sad for this. daddy look's at theire scar's on theire stomach. the twin's scream to mommy and daddy. "mommy! daddy! stomach burn's!" danny slowly-gently use's an icecore on theire bandaged stomach. the twin's make's a scared face in screaming fear "cold-cold." so daddy trie's to calm them down with a fireball to theire chest. he say's "calm down babie's." they clinge himmckenna and sophia fenton are mute-mostly mute. but they really love singing with mommy or daddymckenna and sophia fenton born mutemckenna and sophia fenton don't eat. this worrie's mommy and daddy. but danny (the twin's daddy). trie's them on a dairyfree classic galactosemia safe nutritional plant based vegan chocolate smoothie replacement shake-yogurt on-the-go drink. he hope's they like. wich they lovemckenna and sophia fenton love's kosher dill pickle'smckenna and sophia fenton stuttering disordermckenna and sophia fenton stuttering disorder keep's them mutemckenna and sophia fenton stuttering disorder keep's them shymckenna and sophia fenton voice therapy for nonverbal mute autism-mostly mute. including stutteringmckenna and sophia fenton was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairymckenna and sophia fenton was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairy. this is very sad new's to mommy and daddy to hear about theire infant twin'smckenna and sophia fenton-phantom love's kosher dill pickle'smckenna and sophia fenton-phantom was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairymckenna and sophia fenton-phantom was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairy. this is very sad new's to mommy and daddy to hear about theire infant twin babie'smckenna and sophia phantom love's kosher dill pickle'smckenna and sophia phantom was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairymckenna and sophia phantom was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairy. this is very sad new's to mommy and daddy to hear about theire infant twin babie'sno enzyme's to dygest milk or dairy
Load
ROOTS Vocab Lesson 18
Joanne Wilbers
Friday
Apr 26, 2024
interactiveinterfereintermittentintersectintervaltransacttransfertransfusiontransmittransparent
Load
sped 5/6 reading 641583-1084630-6bkp
lillie
Friday
Apr 26, 2024
autistic mute disorderclassic galactosemia eating disordercommunicate effectivelycommunicate effectively in a unique waycryeating disorder'seffectivelyfingerspellingfive year old fenton twin's mckenna and sophia can't hold silverware correctly. so mommy or daddy has to feed them. this sad moment really worrie's danny and samanthafive year old fenton-phantom twin's mckenna and sophia can't hold silverware correctly. so mommy or daddy has to feed them. this sad moment really worrie's danny and samanthafive year old phantom twin's mckenna and sophia can't hold silverware correctly. so mommy or daddy has to feed them. this sad moment really worrie's danny and samanthafive year old phantom-ghost human twin's. mckenna or sophia fenton or phantom may be mute's. but they do cry alotgalactosemia eating disorderghost human and phantom form girl's. twin sister's- mckenna or sophia fenton or phantom can't walk straight or sit or stand nor lay down straight. due to being born with severe scoliosisghost-human phantom twin's. mckenna or sophia fenton or phantom. unable to keep straight posture. due to being born with severe painfull scoliosisghost. human. or phantom form twin's- mckenna and sophia fenton. as ghost. human. or phantom fourm. can't eat hard food's. only soft meal's. suchas liquid's. grind up dishes. or mash potato or tater salad's for exzamplegrind up food- such as chicken saladliquid foodmash potatosmckenna and sophia fenton are mostly mute. but they communicate effectively in theire unique waymckenna and sophia fenton are mostly mute. rarely talkmckenna and sophia fenton are stutter's they go mutemckenna and sophia fenton were born mute-autistic. they rarely speakmckenna and sophia fenton were born mute. rarely speakmckenna and sophia fenton were born nonverbal mute-autistic. with epileptic absence seizure'smckenna and sophia fenton were born profoundly mutemckenna and sophia fenton were born profoundly mute. rarely speakmckenna and sophia fenton will alway's have fair-white skin due to being born 3- month's premie. as this causing neardeath health problem's sisnce birt. they died during birth. but danny fenton was forced by doctor's to goahead go ghost. and turn themmckenna and sophia fenton-phantom are mostly mute. but they communicate effectively in theire unique waymckenna and sophia fenton-phantom were born nonverbal mute-autisticmckenna and sophia fenton-phantom will alway's have fair-white skin due to being born 3- month's premie. as this causing neardeath health problem's sisnce birt. they died during birth. but danny fenton was forced by doctor's to goahead go ghost. and turn themmckenna and sophia phantom are mostly mute. but they communicate effectively in theire unique waymckenna and sophia phantom are mostly mute. mommy and daddy take's them to speach and voice therapy to learn to speakmckenna and sophia phantom are mostly mute. they rarely speakmckenna and sophia phantom are stutter's they go mutemckenna and sophia phantom will alway's have fair-white skin due to being born 3- month's premie. as this causing neardeath health problem's sisnce birt. they died during birth. but danny fenton was forced by doctor's to goahead go ghost. and turn themmommy and daddy teache's theire deaf-mute nonverbal autistic youngest kid's- twin daughter's: mckenna. and sophia fingerspelling. but the girl's don't understand it. theire having hard time trying to get this. daddy tell's them with interpretation "it's ok girl's. it's gonna' take time. were slowly learning this. well learn together. with eachother." this make's the twin's happy daddy said this to them. they hug tightly to him with tight clinging to him. danny just give's them several kisses to theire headmommy and daddy teache's theire deaf-mute nonverbal autistic youngest kid's- twin daughter's: mckenna. and sophia sign language. but the girl's don't understand it. theire having hard time trying to get this. daddy tell's them with interpretation "it's ok girl's. it's gonna' take time.for sign language. were slowly learning this. well learn together. with eachother. on asl or fingerspelling. including with sign language." this make's the twin's happy daddy said this to them. they hug tightly to him with tight clinging to him. danny kisses them several time's to theire headnonverbal-mute autisticperspectivephantom girl's- mckenna or sophia fenton or phantom. unable to keep straight posturepotato saladrarely ever speakrarely speaksign language
Load
Lesson 31 Test 5/3/24
Mindy Fox
Friday
Apr 26, 2024
acceptaccidentagentallergicannouncecelebratecenturychoicecyclonedangerdecidedigitemergencyexceptfragilegenerategeniusgiganticlegendmarginmessageprincerejoicesaucersuccess
Load
Spelling List 23
Mrs. R
Friday
Apr 26, 2024
August allalmostauthorclawdon'tdrawfaultlawnpausesalttallwasn'twe'veyawn
Load
Friday
Apr 26, 2024
ceilingchutecloseclothesheardherdhourmedalmeddleoursealingshootstraightstraittheirtheretootwo
Load
Week 31
Friday
Apr 26, 2024
agebadgebridgebudgechangechargedodgeedgefudgehugewedge
Load
Suffixes ABLE, ER, OR, LET, LESS, SHIP, WARD
Friday
Apr 26, 2024
backwardboldnesschildlessdarknessdecoratorenjoyableflagshipforwardfriendlyhappilyhomelessnoticeableoutletpreacherrainyrainyrelationshipstormytartletteachervisitor
Load
sped 4/5 reading 641577-1084575-mxxl
lillie
Friday
Apr 26, 2024
adrenalineadrenaline rushautistic mute disordercrydanny and samantha fenton are very worried of theire nonverbal autistic mute-mostly mute youngest children. twin daughter's: mckenna. and sophiadanny and samantha fenton are very worried of theire youngest babies- twin's: mckenna. and sophia. as they findout from doctor's. when theire twin babie's are born. theire born nonverbal autistic mute-mostly mutedanny and samantha fenton's youngest kid's- twin daughter's: mckenna. and sophia. are born profoundly nonverbal mute-mostly mutedanny and samantha fenton-phantom are very worried of theire nonverbal autistic mute-mostly mute youngest children. twin daughter's: mckenna. and sophiadanny and samantha fenton-phantom are very worried of theire youngest babies- twin's: mckenna. and sophia. as they findout from doctor's. when theire twin babie's are born. theire born nonverbal autistic mute-mostly mutedanny and samantha fenton-phantom's youngest kid's- twin daughter's: mckenna. and sophia. are born profoundly nonverbal mute-mostly mutedanny and samantha phantom are very worried of theire nonverbal autistic mute-mostly mute youngest children. twin daughter's: mckenna. and sophiadanny and samantha phantom are very worried of theire youngest babies- twin's: mckenna. and sophia. as they findout from doctor's. when theire twin babie's are born. theire born nonverbal autistic mute-mostly mutedanny and samantha phantom's youngest kid's- twin daughter's: mckenna. and sophia. are born profoundly nonverbal mute-mostly mutedanny fentondanny fenton-phantomdanny phantomdon't underestimateerestimateimmersedimmersed in comic booksimmersed in comic books without uttering a wordmckenna and sophia fenton are stutter's they go mutemckenna and sophia fenton were born severely nonverbal-autisticmckenna and sophia fenton were born severely nonverbal-mostly mutemckenna and sophia fenton were born severely nonverbal-mostly mute autisticmckenna and sophia fenton were born severely nonverbal-mutemckenna and sophia fenton were born severely nonverbal-mute autisticmckenna and sophia fenton-phantom were born nonverbal mute-autisticmckenna and sophia fenton-phantom. in mostly mute. word's goe's a littlebit fast when talking or speakingmckenna and sophia fenton. in mostly mute. word's goe's a littlebit fast when talking or speakingmckenna and sophia phantom. in mostly mute. word's goe's a littlebit fast when talking or speakingmute-autisticnonverbal autistic mostly mutenonverbal-mute autisticovererestimaterapidrapidlysevere mostly-mutesevere mostly-mute-autisticspeak rapidlystutterunderestimateuttering a wordwithout uttering a wordword's goe's a littlebit fast when talking or speaking
Load
Module 9 Week 2
Friday
Apr 26, 2024
abundanceabundantattendanceattendantcompetencecompetencycompetentconsistencyconsistentexpectancyexpectanthesitancyhesitantpermanencepermanentpersistencepersistencypersistentpresencepresent
Load
week 29 Rhyming words
Kimberly Wehner
Friday
Apr 26, 2024
activateappetiteathleteavenuebewarecheapdeletedelightfootwearinvitekangaroolocatereviewsweepthrough
Load
Friday
Apr 26, 2024
afterbarberbirthdayburdenfurnacemarkerparcelperformturtlewar
Load
Unit 6, Lesson 3 Vocabulary
Friday
Apr 26, 2024
addressedalreadyamidbelovedblusterycautiouscoiledcrockdeviousfigurehailedpersuadeplumpsweet
Load
Week 28 Suffixes
Catalina Rincon
Friday
Apr 26, 2024
angrilycarefulcarelesscheerfuldarkenessfearfulfriendlygoodnessgracefulhappilyhomelesshopefulhopelesskindnesssadnesssuddenlyswiftlytireless
Load
Week 4 spelling WS
Jeffrey Katt
Friday
Apr 26, 2024
believingconfuseddecidedhonestimitatedjaillimpingpreacherproduceremindedshakingsittingsmiledsneezedspookystickingtabletrailertrottingwalked
Load
Unit 6 Lessons 11-15
Chrissy Crain
Friday
Apr 26, 2024
Europeactionadditionattentioncaptionchangecottagedirectionfractionfudgehugejudgelargelocomotionnationnudgeoptionrangerevengestations
Load
Friday
Apr 26, 2024
BalloonBoothChewingCountryDewdropDisapproveDiscoveryGrooveImproveKangarooLoseMovementNewbornRemoveShrewd StrewnThrewThroughToothacheUndoWhoever
Load
sped 4/5 reading 641568-1084506-31wx
lillie
Friday
Apr 26, 2024
cajun sauce marinated grilled garlic asparaguscryfive year old fenton-phantom twin's mckenna and sophia can't hold silverware correctly. so mommy or daddy has to feed them. this sad moment really worrie's danny and samanthafive year old phantom-ghost human twin's. mckenna or sophia fenton or phantom may be mute's. but they do cry alotghost-human phantom twin's. mckenna or sophia fenton or phantom. unable to keep straight posture. due to being born with severe painfull scoliosismckenna and sophia fenton are mostly mute. rarely talkmckenna and sophia fenton were born mute-autistic. they rarely speakmckenna and sophia fenton were born mute. rarely speakmckenna and sophia fenton were born nonverbal mute-autistic. with epileptic absence seizure'smckenna and sophia fenton were born profoundly mutemckenna and sophia fenton were born profoundly mute. rarely speakmckenna and sophia fenton will alway's have fair-white skin due to being born 3- month's premie. as this causing neardeath health problem's sisnce birt. they died during birth. but danny fenton was forced by doctor's to goahead go ghost. and turn themmckenna and sophia fenton-phantom will alway's have fair-white skin due to being born 3- month's premie. as this causing neardeath health problem's sisnce birt. they died during birth. but danny fenton was forced by doctor's to goahead go ghost. and turn themmckenna and sophia phantom are mostly mute. mommy and daddy take's them to speach and voice therapy to learn to speakmckenna and sophia phantom are mostly mute. they rarely speakmckenna and sophia phantom will alway's have fair-white skin due to being born 3- month's premie. as this causing neardeath health problem's sisnce birt. they died during birth. but danny fenton was forced by doctor's to goahead go ghost. and turn themmommy and daddy teache's theire deaf-mute nonverbal autistic youngest kid's- twin daughter's: mckenna. and sophia fingerspelling. but the girl's don't understand it. theire having hard time trying to get this. daddy tell's them with interpretation "it's ok girl's. it's gonna' take time. were slowly learning this. well learn together. with eachother." this make's the twin's happy daddy said this to them. they hug tightly to him with tight clinging to himmommy and daddy teache's theire deaf-mute nonverbal autistic youngest kid's- twin daughter's: mckenna. and sophia sign language. but the girl's don't understand it. theire having hard time trying to get this. daddy tell's them with interpretation "it's ok girl's. it's gonna' take time.for sign language. were slowly learning this. well learn together. with eachother. on asl or fingerspelling. including with sign language." this make's the twin's happy daddy said this to them. they hug tightly to him with tight clinging to him
Load
Week 27 - Words with easily confused spellings
Catalina Rincon
Friday
Apr 26, 2024
Sundayaidleall readyalreadyangelangledairydesertdessertdiaryislelooselosepicturepitcherquietquitesundaeweatherwhether
Load
Week 26 Homophones
Catalina Rincon
Friday
Apr 26, 2024
ceilingchutecloseclothesheardherdhourmedalmeddleoursealingshootstraightstraittherethiertootwo
Load
Lesson 27 sentences
Alicia Arriaga
Friday
Apr 26, 2024
barefootbookscookcookbookcrookedfootfootpathhoodhoofliklihoodmistooknookovercookshookstood tookunderstoodwood
Load
Friday
Apr 26, 2024
bazaarbizarreconscienceconsciousdesertdessertemigrateformallyformerlyhardyheartyimmigratelayinglyingmoralmoralepersonalpersonnelprecedeproceed
Load
Group 1 4/29
Christy Mcnamara
Friday
Apr 26, 2024
chippedclippingdrippedflattengrippinghoppingpinnedspinnerstoppingtapped
Load
Friday
Apr 26, 2024
DerbyMunicipalassortedastonishmentclotheslineconsentedconsumedcustomarydeclaredetermineddignityescapeexhaustedexhibithumbleidleintentionpoliterecliningreluctantrookeryslidestubborntripodvigorously
Load
Module 11 Week 1
Kelly Kohmetscher
Friday
Apr 26, 2024
admittedequaledfavoredfittingforgettingglisteninggrammarhappeninghonoredlaboredlimitedmodelingpardonedpermittingpreferredreasoningregularscarredscrappedseniorshudderedsimilarskiddingtutoring
Load
Unit 5 Lesson 6 Spelling
Miriam Milks
Friday
Apr 26, 2024
adjustmentbandagecemeteryclamordehydratediagrammusicianmythologyoptimisticvegetarian
Load
Week 34
Friday
Apr 26, 2024
areabecausebestcheckeddresselseeveryformsgrandhighmatternearnextstandwest
Load
Spelling 3-33
Heather Cunningham
Friday
Apr 26, 2024
caughtenthrallaughtaughtthreadthreatthreethriftythrillthrivethroatthronethrottlethroughthrow
Load
Week 29 Alternate Test
Jennifer Young
Friday
Apr 26, 2024
anonymousdangerousfabulousglamoroushumongousinfamousnumerouspompoustreacherousvenomous
Load
Unit 5 Week 3 Beyond Spelling
Charlotte Rissala
Friday
Apr 26, 2024
currentdisabledisapprovediscomfortdisconnectdiscontentdisheartendismantledismountinaccurateindefiniteinexpensiveinjusticemisbehavemisjudgemistakenmistrustmisunderstandpredispositionprehistoricprejudgeprerequisitepresencepreviewstationary
Load
Spelling 1-33
Heather Cunningham
Friday
Apr 26, 2024
alwaysconecubdigdrivefindfirstfourfrogfunnygamegreenplantsomethingtogether
Load
6.2 Spelling
Bryanna Beasley
Friday
Apr 26, 2024
angriestautomaticcacticrunchierfungikidneysloveliermegaphonepeoplepotatoesscarvesspeciesstrawberriestelevisionworst
Load
sped 4&5 reading 641553-1084284-nx4j
lillie
Friday
Apr 26, 2024
autismautisticcrydanny fentondanny fenton-phantomdanny phantomearthdayfearfenton-phantomfenton-phantom basement. ghost lab. and storm shelterfenton-phantom basement. ghost lab. and storm shelter basementfenton-phantom ghost labfive year old fenton twin's mckenna and sophia can't hold silverware correctly. so mommy or daddy has to feed them. this sad moment really worrie's danny and samanthafive year old fenton-phantom twin's mckenna and sophia can't hold silverware correctly. so mommy or daddy has to feed them. this sad moment really worrie's danny and samanthafive year old phantom twin's mckenna and sophia can't hold silverware correctly. so mommy or daddy has to feed them. this sad moment really worrie's danny and samanthafive year old phantom-ghost human twin's. mckenna or sophia fenton or phantom may be mute's. but they do cry alotghost human and phantom form girl's. twin sister's- mckenna or sophia fenton or phantom can't walk straight or sit or stand nor lay down straight. due to being born with severe scoliosisghost-human phantom twin's. mckenna or sophia fenton or phantom. unable to keep straight posture. due to being born with severe painfull scoliosisghost. human. or phantom form twin's- mckenna and sophia fenton. as ghost. human. or phantom fourm. can't eat hard food's. only soft meal's. suchas liquid's. grind up dishes. or mash potato or tater salad's for exzamplelab. basement. ghost zone. ghost lab. and safety basementmckenna and sophia fenton are mute-mostly mutemckenna and sophia fenton are stutter's they go mutemckenna and sophia fenton were born nonverbal mute-autisticmckenna and sophia fenton-phantom are mute-mostly mutemckenna and sophia fenton-phantom are mute. but love's listening to mommy and daddy sing or singing with mommy and daddymckenna and sophia fenton-phantom are stutter's they go mutemckenna and sophia fenton-phantom were born nonverbal mute-autisticmckenna and sophia phantom are mute-mostly mutemckenna and sophia phantom are stutter's they go mutemckenna and sophia phantom were born nonverbal mute-autisticphantom girl's- mckenna or sophia fenton or phantom. unable to keep straight posturesevere weather safety lab basement
Load
Within Word Pattern - Sort 25
Friday
Apr 26, 2024
barebearcarechairdarkfairfarehairhareharmheartpairparepartpearsharksharpsquarestairstarestartwearwhere
Load
Friday
Apr 26, 2024
bakerbankerbuildercampercatcherclimberdreamerearthfarmerhikerhumbleleaderlearnerlistenerownerpainterplayerradiantreaderreportersingerskaterspeakerterrific
Load
Unit 26 eri Pattern (6)
Friday
Apr 26, 2024
anteriorbacteriacafeteriaclericalcriteriadeteriorateexperienceexperimentexteriorimperialinferiorinteriormaterialmysteriousperiodposteriorserialseveritysuperiorulterior
Load
Unit 5, Week 5
Rosemary Kennedy
Friday
Apr 26, 2024
covercozydinerfavorfrozenhurriedlabellemonmelonpilotplanetrobotshadysilentspiderstomachstudyingtigertinytried
Load
Word List #26
Michele Cassula
Friday
Apr 26, 2024
accessiblecomfortablecongratulationsdangerousedibleendlessenjoyableexcellentfaithfulgraduationhelplessinfinitelyinterestingpatientpowerfulpredictableselflesssenselesssuccessfulvisible
Load
Sort 24 - Syllables and Affixes
Friday
Apr 26, 2024
airplaneawarebarberbarelybewarecarefulcarpetcarrycomparedairydeclaredespairfairygardenhaircuthardlyharvestmarblemarketpardonparentspartnerrepairtoward
Load
Mrs Jackson
Friday
Apr 26, 2024
babychildfootfoxglassgoosemanmatchmousenightpersonstorytoothwoman
Load
Review list 5 / half list
Friday
Apr 26, 2024
coatgrowlightmostonlyourshowtoetoldwho
Load
2nd Grade List 14 Practice
April Banks
Friday
Apr 26, 2024
Mondayautumnbreadbusychinacoverdraweasyeithermonthonceouncepausepencilteacherthousandweather
Load
Unit 6, Week 4
Kaleigh Taylor
Friday
Apr 26, 2024
bicyclebinocularsbisectbiweeklycentimetercentipedecenturytriangletricycletriotripletriplettripodunicornunicycleuniformunifyunisonuniverseuniversity
Load
Spelling Test
Friday
Apr 26, 2024
enginegelatingemstonegenerallygermgiantgiraffejealousyjewelryjewelryjuicejumpyjusticemajorpigeon
Load
Review List 5
Friday
Apr 26, 2024
Joecoatfloatgrowlightmindmostmowonlyourshowtoasttoetoldwho
Load
Spelling List #15 - Review aw, oa, oi, soft g and c
Mrs. Dye
Friday
Apr 26, 2024
cindercitecoastcoincrawldrawinggoatgracegymlawnspicestagetinfoiltoastwage
Load
8.3 spelling
Friday
Apr 26, 2024
admirationadmireconfessconfessionconnectconnectioncontributecontributiondecoratedecorationelectricelectricianmusicmusicianreactreactionselectselectiontensetension
Load
Friday
Apr 26, 2024
cloakidlenoddypalletpeerplumpsnortsuppertuckvoyage
Load